HET BEWIJS

Talloze studies zijn uitgevoerd om de positieve effecten te bewijzen die lichaamsbeweging hebben op de vrijlating van het menselijke groeihormoon en de de effecten van groeihormonen op de samenstelling van het lichaam, en er zijn er nog tal om de rol van niacine bij het verhogen van de reactie van het groeihormoon op lichaamsbeweging te bevestigen. U vindt de volledige details van vele van deze studies op deze pagina, evenals degenen die gerelateerd zijn aan celbeschadiging als gevolg door lichaamsbeweging, het positieve effect van niacine op cel oxidatieve stress en meer.

Studies gerelateerd aan de reactie van het menselijk groeihormoon (HGH) op lichaamsbeweging en de effecten ervan op de lichaamssamenstelling en spiergroei

  • Samenvatting:

    Lichaamsbeweging stimuleert de hypofyse van groeihormoon. HGH begint toe te nemen binnen ongeveer 15 na het begin van lichaamsbeweging. Alle vormen van lichaamsbeweging kunnen mogelijk de afscheiding van HGH stimuleren, en honderden onderzoeken zijn gepubliceerd met een omschrijving van de impact van verschillende soorten lichaamsbeweging (duur en kracht, sprint en marathonlopen enz.) op de afscheding van HGH bij verschillende soorten mensen (jong en oud, mager en obees, getraind en ongetraind).

  • Frystyk, J.: “Exercise and the growth hormone-insulin-like growth factor axis.” Medicine and Science in Sports Exercise. 2010 Jan;42(1):58-66. PMID: 20010129 DOI: 10.1249/MSS.0b013e3181b07d2d 

  • Studie:

    Een sprint van slechts 30 seconden is een mogelijke stimulans voor de vrijlating van het groeihormoon, maar deze reactie verzwakt met herhaalde perioden van sprinten, mogelijk door het verhoogde gehalte van vrije vetzuren (FFS). Dit onderzoek maakte gebruik van nicotinezuur (niacine) om lipolyse (de afbraak van vetten en lipiden om vetzuren vrij te laten) te onderdrukken om te onderzoeken of de groeihormoonreactie op lichaamsbeweging wordt beïnvloed door serum FFA. Zeven gezonde mannen voerden twee sprintoefeningen uit van maximaal 30 seconden op een ergometer, met 4 uur herstel ertussen.  Zij namen tijdens één proef niacine (1g 60 minuten ervoor, 0.5g op 60 minuten en 0,5g 180 minuten na de eerste sprint).

     

  • Resultaten:

    Serum FFA was niet significant anders voor sprint 1 bij beide proeven. Bij de niacineproef was het gehalte FFA aanzienlijk lager, onmiddellijk voor sprint 2. Bij de niacineproef waren piek- en geïntegreerde HGH significant hoger na sprint 2 in vergelijking met sprint 1 en vergeleken met sprint 2 in de niet-niacineproef.

     

  • Conclusie:

    Het onderdrukken van lipolyse met niacine resulteerde in een aanzienlijk hogere reactie van HGH op de tweede van twee sprints. Dit suggereert dan FFAs een rol spelen bij het reguleren van de HGH-reactie op lichaamsbeweging.

  • Stokes, KA., Tyler, C., Gilbert, KL.: “The growth hormone response to repeated bouts of sprint exercise with and without suppression of lipolysis in men.”  Journal of Applied Physiology.2008 Mar;104(3):724-8. PMID: 18187617 DOI: 10.1152/japplphysiol.00534.2007

  • Onderzoek:

    8 gezonde mannen voltooiden 3 afzonderlijke sprintproeven met  fietsergometer.  A bestond uit twee sprints van 30 seconden met 60 minuten herstel. Proef B bestond uit twee sprints van 30 seconden, met 240 minuten herstel en proef C bestond uit een enkele sprint van 30 seconden, uitgevoerd op de dag na proef B. Van elke sprint werden bloedmonsters afgenomen tijdens de rust- en herstelperiodes om de HGH-reactie op lichaamsbewegin te bepalen.

  • Resultaten:

    HGH werd onmiddellijk na proef A verhoogd, net voor de tweede sprint. Er was geen verdere toename na de tweede sprint. Tijdens proef B was er ee trend voor een kleinere HGH-reactie op de tweede sprint en er was geen verschil in HGH-reactie op het sprinten tijdens opeenvolgende dagen (proeven B en C).

  • Conclusie:

    Een enkele sprint van 30 seconden op een fietsergometer zorgt voor een opvallende stijging in HGH, welke tussen de 90 en 120 minuten na de sprint verhoogd blijft.  Wanneer twee sprints worden onderbroken door 60 minuten herstel, is de HGH-reactie op de tweede sprint verhoogd.

  • Stokes, K., Nevill, M., Frystyk, J., Lakomy, H., and Hall, G.: “ Human growth hormone responses to repeated bouts of sprint exercise with different recovery periods between bouts.” Journal of Applied Physiology (1985). 2005 Oct;99(4): 1254-61. Epub 2005 May 26, PMID: 15920098  DOI: http://jap.physiology.org/content/99/4/1254

  • Studie:

    11 sprint-getrainde (6 mannen en 5 vrouwen) en 12 duur-getrainde (6 mannen en 6 vrouwen) atleten voerden een sprint van maximaal 30 seconden uit op een niet-gemotoriseerde loopband om de HGH-reactie op loopband-sprinten te observeren bij beide soorten atleten.

  • Resultaten:

    Serum HGH was hoger bij sprint-getrainde atleten maar was niet statistisch verschillende tussen mannen en vrouwen. HGH was ongeveer 10 keer hoger bij sprint-getrainde atleten na 1 uur herstel. 82% van de variatie in piek-HGH-reactie kwam dor de piek krachtuitvoer en piek bloedlactaat-reactie op de sprint.

  • Conclusie:

    De stijging in HGH als gevolg door lichaamsbeweging kan belangrijke fysiologische effecten hebben bij sprint-getrainde atleten, waaronder verhoogde eiwitsynthese en verminderde afbraak van eiwitten, wat leidt tot het behoud van of vermeerdering van spiermassa.

  • Nevill, ME., Holmyard, DJ., Hall, GM., Allsop, P., van Oosterhout, A., Burrin, JM., and Nevill, AM.: “Growth hormone responses to treadmill sprinting in sprint-and-endurance-trained athletes.” European Journal of Applied Psychology, 1996;72(5-6):460-7. PMID: 8925817 DOI: 10.1007/BF00242276 

  • Studie:

    9 mannelijke proefpersonen voltooiden sprintproeven met fietsergometer bestaande uit 2 cycli, waarbij eenmaal een enkele sprint van 6 seconden wordt uitgevoerd en eenmaal een enkele sprint van maximaal 30 seconden. o 3 van de deelnemers voltooiden een verdere controleproef zonder lichaamsbeweging.

     

  • Resultaten:

    De gemiddelde serum HGH-waarden waren meer dan 450% hoger na de 30 seconden sprint dan na de 6 seconden sprint en bleven zo’n 90-120 minuten verhoogd in vergelijking met ongeveer 60 minuten na de 6 seconden sprint. HGH-waarden waren op geen enkel moment tijdens de controleproef waarbij geen lichaamsbeweging werd uitgevoerd verhoogd tot boven de normale waarden.

     

  • Conclusie:

    Lichaamsbeweging is een krachtige stimulans voor de vrijlating van HGH. The duur van de uitvoer van een maximale sprint lijkt de mate van de HGH-reactie te bepalen, alhoewel het mechanisme hiervoor nog onduidelijk is.

  • Stokes, KA., Nevill, ME., Hall, GM., and Lakomy, HK.: “The time course of the human growth hormone response to a 6 s and a 30 s cycle ergometer sprint.” Journal of Sports Sciences, 2002 Jun;20(6):487-94. PMID: 12137178  DOI: http://www.tandfonline.com/doi/abs/10.1080/02640410252925152

  • Onderzoek:

    10 mannelijke proefpersonen voltooiden twee sprints van 30 seconden uit, met daartussenin twee herstelperioden van 1 uur, met een weerstand gelijk aan 7,5% (snelle proef) en 10% (langzame proef) van de lichaamsmassa. Er werden bloedmonsters afgenomen tijdens rustperiodes, tussen de twee sprints en 1 uur na de de tweede sprint.

  • Resultaten:

    De eerste sprint tijdens elke proef zorgde voor een HGH-reactie, welke 60 minuten na de eerste sprint nog steeds verhoogd was. Er was geen HGH-reactie op de tweede sprint. HGH-reactie had de neiging om groter te zijn in de eerste proef.

  • Conclusie:

    Herhaaldelijk sprintfietsen resulteerde in een vermindering van de reactie van HGH.

     

  • Stokes, K., Nevill, ME., Hall, GM., and Lakomy, HK.: “Growth hormone responses to repeated maximal cycle ergometer exercise at different pedaling rates.” Journal of Applied Physiology (1985). 2002 Feb;92(2):602-8. PMID: 11796670 DOI: http://jap.physiology.org/content/92/2/602.long

  • Studie:

    7 matig getrainde mannen namen deel aan 30 minuten lichaamsbeweging tegen 70% maximale O2-consumptie op een fietsergometer op een controledag, een opeenvolgende dag met lichaamsbeweging (om 1000, 1130 en 1300) en een verlate dag met lichaamsbeweging (om 1000, 1400 en 1800). HGH werd gemeten om de 5-10 minuten, 24 uur lang.

     

  • Resultaten:

    HGH-concentraties overdag waren 150-160% hoger gedurende de tweede en verlate dagen met lichaamsbeweging dan tijdens de controledagen. HGH verhoogde progressief met elke opeenvolgende periode van lichaamsbeweging, met een iets hogere verhoging op de dag met vertraagde lichaamsbeweging. Er was geen verandering in HGH-vrijlating tijdens de slaap.

     

  • Conclusie:

    HGH-reactie op acute aerobics-oefeningen verhoogde met herhaalde perioden van lichaamsbeweging.

  • Kanaley, JA., Weltman, JY, Veldhuis, JD., Rogol, AD., Hartman, ML., and Weltman, A.: “Human growth hormone response to repeated bouts of aerobic exercise.” Journal of Applied Physiology. 1997 Nov;83(5):1756-61. PMID: 9375348 DOI: http://jap.physiology.org/content/83/5/1756.long

  • Studie:

    10 gezonde mannelijke vrijwilligers tussen de 18 en 35 jaar voerden progressieve fiets-oefeningen uit op een ergometer na ’s nachts vasten en op opeenvolgende ochtenden voerden zij perioden van 1, 5 en 10 minuten lichaamsbeweging uit met constante snelheid, ofwel hoge of lage intensiteit. Elke periode werd gescheiden door een interval van 1 uur.

     

  • Resultaten:

    Lage intensiteit lichaamsbeweging produceerde geen aanzienlijke verhoging in HGH. Maar bij 9 van de 10 proefpersonen steeg na 10 minuten hoge intensiteit lichaamsbeweging de HGH-waarde aanzienlijk.

     

  • Conclusie:

    Een minimumduur van 10 minuten hoge intensiteit lichaamsbeweging verhoogde consequent circulerend HGH bij volwassen mannen.

  • Felsing, NE., Brael., JA., and Cooper, DM.: “Effect of high and low intensity exercise on circulating growth hormone in men.” Journal of Clinical Endocrinology and Metabolism. 1992 Jul;75(1):157-62 PMID: 1619005 DOI: http://press.endocrine.org/doi/abs/10.1210/jcem.75.1.1619005

  • Studie:

    9 mannelijke proefpersonen voerden 6 willekeurig toegewezen zware krachttraining-protocollen (HREPs) uit, bestaande uit identiek geordende oefeningen ontworpen ter controle van belasting (5 vs 10 herhalingen max.) rustperiode (1 vs 3 minuten) en totale werkeffecten. De concentraties serum groeihormoon, testosteron, somatomedine-C, glucose en lactaat werden gemeten vóór de inspanning, tijdens de inspanning (na 4 of 8 oefeningen) en 0, 5, 15, 30, 60, 90 en 120 minuten na de de inspanningen.

  • Resultaten:

    Alhoewel niet alle HREPs een stijging in HGH veroorzaakten, werden de hoogste niveaus geobserveerd na de oefening-protocol H10/1 (hoog totaal werk, 1 minuut rust, 10-RM belasting) voor zowel tijdelijke als tijdsgeïntegreerde reacties.

     

  • Conclusie:

    Vanwege de mogelijke verschillen in hormonale en groeifactor-vrijlatingen hebben alle HREPs mogelijk niet op dezelfde manier invloed op spier- en weefselgroei.

  • Kraemer, WJ., Marchitelli, L., Gordon, SE., Harman, E., Dziados, JE., Mello, R., Frykman, P., McCurry, D., and Fleck, SJ.: “Hormonal and growth factor responses to heavy resistance exercise protocols.” Journal of Applied Physiology. 1990 Oct;69(4):1442-50. PMID: 2262468 DOI: http://jap.physiology.org/content/69/4/1442  

  • Studie:

    Een zware krachttrainingsoefningsessie bestaande uit bankdrukken, bilaterale leg press en een sit-up-oefening werd uitgevoerd door 8 jonge vrouwen en 8 jonge mannen (in de leeftijdsgroep van 30 jaar), 7 vrouwen van middelbare leeftijd en 8 mannen van middelbare leeftijd (in de leeftijdsgroep van 50 jaar) en 8 oudere vrouwen en 8 oudere mannen (in de leeftijdsgroep van 70 jaar). 5 sets van elke oefening met de maximale belasting mogelijk voor 10 herhalingen per set werden uitgevoerd met 3 minuten herstel tussen de sets.

     

  • Resultaten:

    Hoewel er geen verandering was in HGH-waarden bij de oudere mannen of vrouwen, was HGH toegenomen bij jonge vrouwen en jonge mannen, evenals bij de vrouwen en mannen van middelbare leeftijd. De toename was hoger bij jonge vrouwen en jonge mannen.

     

  • Conclusie:

    Zware krachttrainingsoefeningen zorgen voor een HGH-reactie, maar deze reactie is lager naarmate de leeftijd van mannen en vrouwen hoger is.

  • Hakkinen, K., Pakarinen, A.: “Acute hormonal responses to heavy resistance exercise in men and women at different ages.” International Journal of Sports Medicine. 1995 Nov;16(8):507-13. PMID: 8776203 DOI: 10.1055/s-2007-973045

  • Studie:

    96 recreatief getrainde atleten (63 mannen en 33 vrouwen) namen deel aan een placebo-gecontroleerd, dubbelblind onderzoek van 8 weken. Mannen ontvangen ofwel groeihormoon, testosteron, gecombineerde behandelingen of een placebo. Vrouwen ontvingen ofwel groeihormoon of een placebo. De variabelen van lichaamssamenstellingen en fysieke prestaties werden gemeten.

     

  • Resultaten:

    Groeihormoon reduceerde vetmassa aanzienlijk en verhoogde de magere lichaamsmassa. Het verhoogde ook het sprintvermogen aanzienlijk met 3,9%. Deze toename was niet behouden, 6 weken na beëindiging van HGH.

     

  • Conclusie:

    Groeihormoonsupplementatie was van invloed op de lichaamssamenstelling en verhoogde de sprintcapaciteit.

  • Meinhardt, U., Nelson, AE., Hansen, JL., Birzniece, V., Clifford, D., Leung, KC., Graham, K., Ho, KK.: “The effects of growth hormone on body composition and physical performance in recreational athletes: a randomized trial.” Annals of Internal Medicine, 2010 May 4;152(9):568-77 PMID: 20439575 DOI: 10.7326/0003-4819-152-9-201005040-00007

  • Studie:

    7 gezonde mannen en vrouwen tussen de 18 en 23 jaar ontvingen HGH via onderarm-slagaderinfuus gedurende 6 uur. De effecten van HGH op de aminozuur- en glucosebalansen in de onderarm werden na 3 en 6 uur gemeten.

     

  • Resultaten:

    Er was geen verandering in de opname van glucose, maar HGH onderdrukte de vrijlating van fenylalanine, leucine, totale vertakte aminozuren en essentiële neutrale aminozuren in de onderarm.

     

  • Conclusie:

    Het resultaat suggereert dat HGH skeletspier eiwitsynthese stimuleert.

  • Fryburg, DA., Gelfand, RA., Barrett, EJ.: “Growth hormone acutely stimulates forearm muscle protein synthesis is normal humans.” American Journal of Physiology. 1991, Mar;260(3 Pt 1):E499-504. PMID: 2003602 DOI: http://ajpendo.physiology.org/content/260/3/E499

  • Studie:

    Normale vrijwilligers in de leeftijd van 18 tot 24 jaar ontvingen een infusie van 3H-fenylanine en 14C-leucine in de onderarmen gedurende een periode van 8 uur. Basale monsters om te bepalen hoeveel aminozuurkinetica waren opgenomen in de onderarm en het gehele lichaam tussen de 90 en 120 minuten. HGH was daarna toegevoegd aan de infusie om de HGH-concentratie te verhogen.

     

  • Resultaten:

    Het niveau van de insuline-achtige groeifactor (IGF-1) was gestegen. HGH onderdrukte de vrijlating van fenylanine en leucine in de onderarm door 3H-fenylanine en 14C-leucine te verhogen. Oxidatieve leucine nam af. De mate van verschijning van niet-oxidatieve leucine, proteolyse in het gehele lichaam en leucine veranderde niet.

     

  • Conclusie:

    Acute stimulatie van spier- maar niet eiwitsynthese van het gehele lichaam door systematisch HGH te infuseren suggereert dat spiereiwit acuut en specifiek wordt gereguleerd door HGH.

  • Fryburg, DA., Barrett, EJ.: “Growth hormone stimulates skeletal muscle but not whole-body protein synthesis in humans.” Metabolism Clinical & Experimental. 1993 Sep;42(9):1223-7. PMID: 84127802 DOI: http://www.metabolismjournal.com/article/0026-0495(93)90285-V/abstract 

  • Studie:

    21 gezonde mannen tussen de 61 en 81 jaar namen deel aan een onderzoek van 6 maanden. 12 van de mannen ontvingen 3 maal per week HGH en 9 van de mannen ontvingen geen behandeling.

     

  • Resultaten:

    In de HGH-groep steeg het gemiddelde niveau van plasma IGF-1 naar het jeugdige bereik, vergezeld door een stijging van 8,8% in magere spiermassa, een afname van 14,14% van vetweefselmassa, 1,6% stijging in  gemiddelde lumbale wervelkolom botdichtheid en een stijging van 7,1% in huiddikte. Er was geen aanzienlijke verandering in een van deze zaken bij de niet-HGH-groep.

  • Conclusie:

    Verminderde afgifte van HGH is deels verantwoordelijk voor de afname van magere spiermassa, het uitzetten van vetweefselmassa en het verdunnen van de huid dat voorkomt bij een oudere leeftijd.

  • Rudman, D., Feller, AG., Nagraj, HS., Gergans, GA., Lalitha, PY., Goldberg, AF., Schlenker, RA., Cohn, L., Rudman, IW., Mattson, DE.: “Effects of human growth hormone in men over 60 years old.” The New England Journal of Medicine. 1990 Jul 5;323(1):1-6 PMID: 2355952 DOI: 10.1056/NEJM199007053230101

  • Studie:

    13 volwassenen met groeihormoondeficiëntie.

     

  • Resultaten:

    Magere lichaamsmassa nam af en vetmassa nam aanzienlijk af bij de groep die HGH nam. HGH verhoogde erytrocytenmassa en plasmavolume aanzienlijk en totale bloedvolume, Serum IGF-1 en IGF-bindend eiwit-3 was verhoogd.  Geen aanzienlijke veranderingen in de lichaamssamenstelling of het bloedvolume werden waargenomen bij de placebogroep.

  • Conclusie:

    HGH stimuleert de productie van rode bloedcellen (erytropoëse) bj volwassen GHD, evenals plasmavolume en totale bloedvolume, welke kunnen bijdragen aan de verhoogde sportprestaties zoals waargenomen in de HGH-groep.

  • Christ, ER., Cummings, MH., Westwood, NB., Sawyer, BM., Pearson, TC., Sönksen, PH., Russell-Jones, DL.: “The importance of growth hormone in the regulation of erythropoiesis, red cell mass, and plasma volume in adults with growth hormone deficiency.” Journal of Clinical Endocrinology and Metabolism. 1997 Sep;82(9):2985-90 PMID: 9284731 DOI:  10.1210/jcem.82.9.4199

Studies gerelateerd aan het effect van niacine op HGH en endotheliale functies

  • Studie:

    8 gezonde mannelijke deelnemers ontvingen ofwel nicotinezuur (niacine) of adenosine (beide lipolyseremmers) om te bepalen wat al dan niet de effecten zijn van vrije vetzuren (FFAs) op de plasmaconcentraties van het groeihormoon, cortisol en glucagon.  In de tweede fase van het onderzoek werd een infusie van vetzuren geïntroduceerd bovenop de infusies met niacine en adenosine.

     

  • Resultaten:

    Niacine veroorzaakte een aanzienlijke stijging in HGH. Er vond geen stijging in HGH plaats wanneer aanvullende vetzuren werden geïntroduceerd in de bloedsomloop samen met de niacine.

     

  • Conclusie:

    De aanwezigheid van FFAs remt de vrijlating van HGH. Het onderdrukken van vrije vetzuren stimuleert de afgifte van HGH.

  • Quabbe, HJ., Luyckx, AS., L’age, M., Schwarz, C.: “Growth hormone, cortisol, and glucagon concentrations during plasma free fatty acid depression: different effects of nicotinic acid and an adenosine derivative (BM 11.189).” The Journal of Clinical Endocrinology and Metabolism. 1983 Aug;57(2):410-4. PMID: 6345570 DOI: 10.1210/jcem-57-2-410 

  • Studie:

    De effecten van nicotinezuur en plasma HGH (menselijk groeihormoon), FFA (vrije vetzuren) en glucose nbij normale, obese patiënten met hypopituïtarisme.

     

  • Resultaten:

    Bij normale patiënten was er een acute reducering in plasma FFA gevolgd door een duidelijke, progressieve secundaire stijging. Er was een aanzienlijke stijging in HGH gevolgd door een reducering in plasma FFA. Er was geen aanzienlijke verandering in plasma HGH bij obese patiënten en patiënten met hypopituïtarisme, alhoewel er een meer uitgesproken reducering en snelle stijging was van plasma FFA bij obese proefpersonen  vergeleken met normale proefpersonen, en bij patiënten met hypopituïtarisme was de secundaire stijging van plasma FFA traag en verminderd.

     

  • Conclusie:

    Het lijkt erop dat de late terugkaatsing van plasma FFA na de toediening van nicotinezuur op zijn minst deels gerelateerd is aan de stijging in HGH-afgifte.

  • Irie, M., Tsushima, T., Sakuma, M.: “Effect of nicotinic acid administration on plasma HGH, FFA and glucose in obese subjects and in hypopituitary patients.” Metabolism Clinical and Experimental. 1970 Nov;19(11):972-9. PMID: 5479511 DOI: http://dx.doi.org/10.1016/0026-0495(70)90043-0

  • Studie:

    127 gezonde, niet-rokende mannen en vrouwen in de leeftijden van 48-77 jaar die geen medicijnen gebruikten namen deel aan een onderzoek om de hypothese dat een hogere inname van niacine wordt geassocieerd met arteria brachialis doorstroming gemedieerde dilatatie (FMD) te testen en de oxidatieve stress te verminderen. Alle deelnemers onthielden zich 2 weken voor het onderzoek van het nemen van voedingssupplementen. Het onderzoek werd uitgevoerd gevolgd door 12 uur vasten (geen voedsel en cafeïne) en 24 uur onthouding van lichaamsbeweging en alcohol.

     

  • Resultaten:

    Doostroming gemedieerde dilatie was 25% meer bij proefpersonen met bovengemiddelde niacine-inname via voeding dan bij proefpersonen met ondermaatse inname. Niacine-inname via de voeding (bovengemiddeld vs. ondermaats) was een onafhankelijke voorspeller van FMD. Plasma geoxideerde lipoproteïne met lage dichtheid, een markering van systematische oxidatieve stress, was omgekeerd evenredig aan niacine-inname en was lager bij proefpersonen met boven- versus ondermaatse niacine-inname. In endotheelcellen bemonsterd uit de brachiale slagader van een subgroep was niacine uit voeding omgekeerd evenredig aan nitrotyrosine, een markering van peroxynitriet-gemedieerde oxidatieve schade en expressie van het enzym prooxidant, NADPH oxidase. Deze markeringen waren lager bij proefpersonen met bovengemiddelde vs. ondermaatse niacine-inname.

     

  • Conclusie:

    De bevindingen ondersteunen de hypothese dat niacine-inname via de voeding wordt geassocieerd met verbeterde vasculaire endotheelfunctie gerelateerd aan lagere systemische en vasculaire oxidatieve stress onder gezonde volwassenen van middelbare leeftijd en ouder.

  • Kaplon, RE., Gano, LB., Seals, DR.: “Vascular endothelial function and oxidative stress are related to dietary niacin intake among healthy middle-aged and older adults.” Journal of Applied Physiology. 2014 Jan 15;116(2):156-63. PMID: 24311750 PMCID: PMC3921358 DOI: 10.1152/japplphysiol.00969.2013

  • Studie:

    In een dubbel-blind, placebo-gecontroleerde proef ontvingen 63 mannen in de leeftijd van 35-60 jaar na een myocardinfarct (hartaanval) ofwel een dagelijkse combinatie van 1000mg niacine en 20mg laropiprant (een drug die wordt gebruikt in combinatie met niacine om het bloedcholesterol te verlagen) 4 weken lang, met een toename tot 2000/40mg de dag daarop, of een placebo. Aan het begin en na 12 weken werden de bloedstroming-gemedieerde dilatie (FMD), nitroglycerine-geïnduceerde  verwijding van de slagader, totale cholesterol (TC), LDL-C, HDL-C, triglyceriden (TG),  lipoproteïne (a) [Lp(a)] en apolipoproteïne (Apo) A1/B gemeten.

     

  • Resultaten:

    FDM was aanzienlijk verhoogd bij de niacine-/laropiprant-groep, maar niet bij de placebogroep. GTN-verwijding was ook toegenomen, maar niet bij de placebogroep. Niacine/laropiprant reduceerde TC en LDL-C en verhoogde HDL-C zonder invloed op TG, terwijl er geen veranderingen waren in de placebogroep. Lp(a) en ApoB waren aanzienlijk lager in de niacine-/laropiprant-groep, met geen verschil in de placebogroep. ApoA1 veranderde bij geen van de groepen.

  • Conclusie:

    Niacine/laropiprant verbetert endotheel-afhankelijke en endotheel-onafhankelijke dilatie van de slagader.

  • Bregar, U., Jug, B., Keber, I., Cevc, M., Sebestjen, M.: “Extended-release niacin/laropiprant improves endothelial function in patients after myocardial infarction.” Heart and Vessels. 2014 May;29(3):313-9. PMID: 23712600 DOI: 10.1007/s00380-013-0367-5 

  • Studie:

    Een gerandomiseerd gecontroleerd onderzoek was uitgevoerd om te bepalen wat de kortetermijneffecten zijn van extended-release niacine (ERN) op de endotheelfunctie bij 19 volwassen HIV-patiënten met laag HDL-c. Dit was gemeten door middel van bloodstroom-gemedieerde vaatverwijding (FMD) van de armslagader.  Deelnemers aan de stabiele HAART met HDL-c minder dan 40 mg/dl tijdens het vasten en lage dichtheid lipoproteïne-cholesterol van minder dan 130 mg/dl ontvingen ofwel ERN (500mg per nacht, stijgend tot 1500mg voor 12 weken) of besturingsarmen.

     

  • Resultaten:

    Deelnemers die ERN ontvingen hadden een stijging in HDL-c en FMD. De FMD voor ERN aan het einde van het onderzoek was aanzienlijk anders in vergelijking met de controles na het aanpassen voor de basislijnverschillen in FMD en HDL-c.

     

  • Conclusie:

    Kortetermijn-niacinetherapie zou de endotheelfunctie kunnen verbeteren bij HIV-patiënten met laag HDL-c.

  • Chow, DC., Stein, JH., Seto, TB., Mitchell, C., Sriratanaviriyakul, N., Grandinetti, A., Gerschenson, M., Shiramizu, B., Souza, S., Shikuma, C.: “Short-term effects of extended-release niacin on endothelial function in HIV-infected patients on stable antiretroviral therapy.” Official Journal of the International AIDS Society. 2010 Apr 24;24(7):1019-23. PMID: 20216298 PMCID: PMC2925834 DOI: 10.1097/QAD.0b013e3283383016

Studies gerelateerd aan rodebloedcellenomzet en oxidatieve stress als gevolg van lichaamsbeweging tijdens lichaamsbeweging en de effecten van niacine op oxidatieve stress.

  • Samenvatting:

    Rode bloedcellen (RBC) hebben een levensduur van ongeveer 120 dagen, maar intensieve training kan de veroudering versnellen, wat leidt tot het zogenoemde ‘sportbloedarmoede’. Het is bewezen dat fietsen, hardlopen en zwemmen schade kunnen

    aanbrengen aan de rode bloedcellen. Rode bloedcellen zijn vatbaar voor oxidatieve schade vanwege de voortdurende blootstelling aan zuurstof en de hoge concentraties polyonverzadigde vetzuren en heemijzer.  Antioxidanten in spieren en rode bloedcellen kunnen uitgeput raken tijdens lichaamsbeweging en oxidatieve schade kan ook de mogelijkheid van rode bloedcellen om van vorm te veranderen aantasten, wat de doorgang via de kleine bloedvaten en haarvaten kan belemmeren. Dit kan de hoeveelheid zuurstof dat de spieren bereikt tijdens een enkele uitvoering van lichaamsbeweging reduceren en mogelijk de snelheid van vernietiging van rode bloedcellen met lichaamsbeweging op de lange termijn doen stijgen.

     

  • Smith, JA.: “Exercise, training and red blood cell turnover.” Sports Medicine. 1995 Jan;19(1):9-31 PMID: 7740249 DOI: 10.2165/00007256-199519010-00002 

  • Samenvatting:

    De belangrijkste functie van rode bloedcellen (RBC) bij lichaamsbeweging is de transport van O2 van de longen naar de weefsels en de levering van metabolisch geproduceerd CO2 naar de longen voor uitademing. Getrainde atleten, voornamelijk in duursport, hebben een verminderd hematocriet (RBC-volume).  Dit is ook bekend als ‘sport-bloedarmoede’. Lichaamsbeweging kan de RBC-massa doen verminderen. Dit wordt veroorzaakt door het barsten van rode bloedvaten wanneer deze door de haarvaten passeren in samengetrokken spieren, en door de compressie van RBCs, bijv. invoetzolen tijdens het hardlopen en in de handpalmen van gewichtheffers. Dit kan leiden tot een vermindering in de gemiddelde leeftijd van de populatie van circulerende rode bloedcellen bij getrainde atleten.

  • Mairbäurl, H.: “Red blood cells in sports: effects of exercise and training on oxygen supply by red blood cells.”  Frontiers in Physiology. 2013 Nov 12;4:332. PMID: 24273518 PMCID: PMC3824146 DOI: 10.3389/fphys.2013.00332

  • Samenvatting:

    Onderzoeksbewijs suggereert dat inspannende aerobicsoefeningen worden geassocieerd met oxidatieve stress en weefselschade. De oorzaak van door inspanning geïnduceerde oxidatieve schade wordt gedacht te worden veroorzaakt door de vorming van zuurstofvrije radicalen en andere reactieve zuurstofsoorten (ROS). Antioxidanten spelen een vitale rol bij het beschermen van weefsels tegen excessieve oxidatieve schade tijdens lichaamsbeweging en het uitputten van de natuurlijke antioxidantsystemen van het lichaam zorgt voor een stijging van vatbaarheid van weefsels en cellen voor ROS. Omdat acute inspannende oefeningen en training de antioxidantconsumptie verhoogde, zouden voedingssupplementen van specifieke antioxidanten nuttig zijn.

  • Ji, LL.: “Oxidative stress during exercise: implication of antioxidant nutrients.” Free Radical Biology and Medicine. 1995 Jun;18(6):1079-86 PMID: 7628730 DOI: 0891584994002123  

  • Studie:

    Inspannende fysieke activiteit staat bekend om het verhogen van de productie van reactieve zuurstofverbindingen (ROS), wat wordt geassocieerd met de uitputting van het antioxidantenafweersysteem. 53 gezonde mannelijke vrijwilligers in de leeftijden van 22 en 26 jaar namen deel aan een onderzoek waarin het niveau van lipideperoxidatie en antioxidantcomponenten in het bloed van sportmannen in rustomstandigheden werd vergeleken met degenen in een controlegroep van gelijke leeftijden.

  • Resultaten:

    Bij sportmannen was er een aanzienlijke stijging in thiobarbituurzuur reactieve stoffen (TBARS – een meting van de schade geproduceerd door oxidatieve stress) en geconjugeerde diënen. Er was een afname in niveaus van de antioxidanten ascorbinezuur en glutathion. Superoxide dismutase-activiteit (een enzym dat schadelijke moleculen in cellen afbreekt) steeg met 52% en glutathion peroxidase (die beschermt tegen oxidatieve schade) met 42% in de rode bloedcellen van sporters in vergelijking met controles.

     

  • Conclusie:

    Het is aangetoond dat voedingssupplementatie met antioxidantvitaminen een positieve uitwerking heeft op het tegengaan van oxidatieve stress, en het is ontdekt dat aanvullende glutathion het uithoudingsvermogen van atleten verbetert, waarbij de kritische rol van glutathion wordt gedemonstreerd, wat suggereert dat behandelingsproefnemingen een mengeling van antioxidanten moeten bevatten in plaats een enkele antioxidant.

  • Balakrishnan, SD., Anuradha, CV.: “Exercise, depletion of antioxidants and antioxidant manipulation.” Cell Biochemistry and Function. 1998 Dec;16(4):269-75. PMID: 9857489 DOI:

    10.1002/(SICI)1099-0844(1998120)16:4<269::AID-CBF797>3.0.CO;2-B

  • Studie:

    6 goed getrainde atleten hebben bloedmonsters laten afnemen voor en 72 uur na het deelnemen aan de “Marathon of Sands” extreme hardloopwedstrijd bestaande uit 6 lange duratieraces in de woestijn, om te bepalen of extreem hardlopen van invloed is op de enzymatische en niet-enzymatische antioxidantstatus.

     

  • Resultaten:

    Een aanzienlijk verandering in bloedantioxidantenafweersysteemcapaciteit was geïnduceerd door de Marathon of Sands. Aanzienlijke verminderingen in erythrocyten superoxide dismutase-activiteit, plasmaconcentraties van retinol, betacaroteen en andere carotenoïden werden 72 uur na de race opgenomen, welke werden geassocieerd met een stijging in RBC-glutathion (een antioxidant) en in plasma-TBARS (een meting van de schade die is geproduceerd door oxidatieve stress) niveaus.

     

  • Conclusie:

    Een dergelijke  extreme duurhardloopwedstrijd induceerde een onbalans tussen oxidant- en antioxidantbescherming, waardoor de afweercapaciteit van het oxidant van het bloed werd verminderd.

  • Machefer, G., Groussard, C., Rannou-Bekono, F., Zouha,l H., Faure, H., Vincent, S., Cillard, J., Gratas-Delamarche, A.: “Extreme running competition decreases blood antioxidant defense capacity.” Journal of the American College of Nutrition. 2004 Aug;23(4):358-64. PMID: 15310740

  • Studie:

    Dit onderzoek onderzocht het effect van niacine op excessieve leververvetting, productie van reactieve zuurstofverbindingen (ROS), afscheiding van inflammatoire mediator IL-8 veroorzaakt door niet-alcoholische vetleverziekte. Palmitinezuur werd gebruikt om menselijk hepatoblastoma cellijn HepG2 of humane primaire hepatocyten (levercellen) te behandelen, waarna zij werden behandeld met niacine of een controle voor 24 uur.

     

  • Resultaten:

    Niacine remde door palmitinezuur-geïnduceerde vetophoping in menselijke hepatocyten aanzienlijk met maar liefst 45-62%. Niacine reduceerde de productie van hepatocyten ROS, door palmitinezuur-geïnduceerde IL-8 niveaus en remde de activiteit van NADPH oxidase.

     

  • Conclusie:

    Niacine reduceert levervetophoping en ROS-productie door de activiteit van hepatocyt DGAT2 en NADPH oxidase te remmen. Verminderde ROS-productie kan hebben bijgewerkt aan de remming van pro-inflammatoire IL-8-niveaus.

  • Ganji, SH., Kashyap, ML., Kamanna, VS.: “Niacin inhibits fat accumulation, oxidative stress, and inflammatory cytokine IL-8 in cultured hepatocytes: impact on non-alcoholic fatty liver disease.” Metabolism Clinical and Experimental. 2015 Sep;64(9):982-90. PMID: 26024755 DOI: 10.1016/j.metabol.2015.05.002

  • Studie:

    17 patiënten met hypercholesterolemie en laag HDL-C en 8 gezonde controle-testpersonen werden 12 weken lang behandeld met niacine. De niveaus van het lipidenprofiel, oxidatieve stress en C-reactief proteïne (CRP) werden bij aanvang van het onderzoek gemeten en 2 en 12 weken na aanvang van de behandeling met niacine.

     

  • Resultaten:

    Niacinebehandeling bij mensen met  hypercholesterolemie zorgde voor een aanzienlijke stijging in de niveau van HDL-C en apolipoproteïne A1, en een daling in het niveau van triglyceride.  Niacine verlaagde ook de oxidatieve stressniveaus aanzienlijk. Serum CRP-niveaus werden niet beïnvloed, maar een correlatie tussen CRP en HDL-niveaus werd gevonden bij de berekening van de resultaten.

  • Conclusie:

    Niacinebehandeling bij mensen met hypercholesterolemie en lage HDL-niveaus zorgde voor een aanzienlijke daling in de status van oxidatieve stress, wat een aanvullend positief effect aangeeft van niacine dat verder gaat dan het vermogen om het lipideprofiel aan te tasten.

  • Hamoud, S., Kaplan, M., Meilin, E., Hassan, A., Torgovicky, R., Cohen, R., Hayek, T.: “Niacin administration significantly reduces oxidative stress in patients with hypercholesterolemia and low levels of high-density lipoprotein cholesterol.” American Journal of the Medical Sciences. 2013 Mar;345(3):195-9 PMID: 22990043 DOI: 10.1097/MAJ.0b013e3182548c28

Studies gerelateerd aan de effecten van niacine op HDL- en LDL-cholesterol

  • Samenvatting:

    Veranderingen in de gewoontes van de moderne leefwijze zoals voeding en lichamelijke activiteit hebben geleid tot overdreven  en langdurige staten van postprandiale hyperlipidemie (abnormaal hoge bloedconcentratie van vetten of lipiden) gevolgd door meerdere vetrijke maaltijden gedurende de dag. Studies hebben aangetoond dat niacine de vasten niveaus van plasma van zeer lage dichtheid lipoproteïnen (VLDL), lage dichtheid lipoproteïne cholesterol (LDL-C) en lipoproteïne [a] (Lp[a]), en het kan hoge dichtheid lipoproteïne cholesterol (HDL-C) verhogen.

  • Montserrat-de la Paz, S.,  Bermudez, B., Naranjo, MC., Lopez, S., Abia, R., Muriana, FJ.: “Pharmacological effects of niacin on acute hyperlipemia.” Current Medicinal Chemistry. 2016 Apr 11 PMID: 27063258

  • Studie:

    Gerandomseerde controleproeven en vergelijkende cohortonderzoek werd uitgevoerd op de effectiviteit van Niaspan (extended-release niacine) op serum lipiden.

     

  • Resultaten:

    LDL-cholesterol, triclyceriden en lipoproteïne(a) daalden allen respectievelijk met 13, 26 en 17% en HDL-cholesterol steeg met 18% in vier  gerandomiseerde controleproeven. Een additionele 22% verlaging in LDL-cholesterol, 7% in triglyceriden en 6% in lipoproteïne(a) niveaus werd aangetoond in vier vergelijkende cohortproeven met behulp van een combinatie van Niaspan en statines.

     

  • Conclusie:

    Niaspan verhoogt het HDL-cholesterol effectief (met positieve invloed op triglyceriden en lipoproteïne(a)) en kan veilig worden gecombineerd met statines.

  • Birjmohun, RS., Hutten, BA., Kastelein, JJ., Stroes, ES.: “Increasing HDL cholesterol with extended-release nicotinic acid: from promise to practice.” The Netherlands Journal of Medicine. 2004 Jul-Aug;62(7):229-34. PMID: 15554597 DOI: http://www.njmonline.nl/getpdf.php?id=147

  • Studie:

    12 proefpersonen met een geschiedenis van  cardiovasculaire ziekte ontvingen atorvastatine of een combinatietherapie van atorvastatine en niacine. De concentratie van hoge dichtheid lipoproteïne (HDL) en zijn 3 subklassen (small, medium en large) werd gemeten bij het begin van de studie en na 1 jaar behandeling.

     

  • Resultaten:

    Atorvastatine verlaagde LDL- (lage dichtheid lipoproteïne) cholesterol met 39% en verhoogde HDL-cholesterol met 11%, maar verhoogde HDL-PIMA of macrofaag cholesterol efflux niet. De combinatie van atorvastatine en niacine verhoogde HDL-cholesterol met 39% en  HDL-PIMA met 14%. Combinatietherapie verhoogde macrofaag cholesterol efflux capaciteit (16%, P <0,0001), maar niet ABCA1-specifiek efflux.

     

  • Conclusie:

    Niacine toevoegen aan een behandeling met statines verhoogde de HDL-cholesterol-niveaus en macrofaag efflux, maar had veel minder effect op HDL-PIMA.

  • Ronsein, GE.,, Hutchins, PM., Isquith, D., Vaisar, T., Zhao, XQ., Heinecke, JW.: “Niacin therapy increases high-density lipoprotein particles and total cholesterol efflux capacity but not ABCA1-specific cholesterol efflux in statin-treated subjects.” Arteriosclerosis, Thrombosis, and Vascular Biology. 2016 Feb;36(2):404-11 PMID: 26681752 DOI: 10.1161/ATVBAHA.115.306268 

Studies gerelateerd aan slaap en de afscheiding van menselijk groeihormoon.

  • Samenvatting:

    Bij volwassenen gebeurt de afscheiding van HGH kort na het in slaap vallen, in associatie met de eerste fase van slow-wave-slaap. Ongeveer 70% va HGH-pulsen tijdens de slaap bij mannen valt samen met slow-wave-slaap. De hoeveelheid GH dat wordt afgescheiden tijdens deze pulsen correleert met de huidige hoeveelheid slow-wave-slaap.

  • Van Cauter, E., Plat, L.: “Physiology of growth hormone secretion during sleep.” The Journal of Pediatrics. 1996 May;128(5 Pt 2):S32-7. PMID: 8627466

  • Studie:

    HGH, insulines, cortisol en glucoseniveaus tijdens de slaap werden 38 nachten lang gemeten bij 8 jongvolwassenen. Bloedmonsters werden om de 30 minuten genomen en EEG en electrooculogram werden opgenomen gedurende de nacht.

  • Resultaten:

    Een HGH-piek trad op bij de aanvang van diepe slaap bij 7 proefpersonen, met een duur van 1,5-3,5 uur. Tijdens de daaropvolgende diepe slaapfases traden er kleinere HGH-pieken op. Een piek in HGH-afscheiding was vertraagd indien de aanvang van slaap was vertraagd. Proefpersonen die 2-3 uur werden wakker gehouden en terug in slaap mochten vallen vertoonden nogmaals een piek in GH-afscheiding.

  • Conclusie:

    De inleiding van de slaap leidt tot een grote piek van HGH-afscheiding.

     

  • Takahash,i Y., Kipnis, DM., Daughaday, WH.: “Growth hormone secretion during sleep.” The Journal of Clinical Investigation. 1968 Sep;47(9):2079-90. PMID: 5675428 PMCID: PMC297368 DOI: 10.1172/JCI105893

  • Studie:

    10 mannelijke proefpersonen namen deel aan een 3 nachten durend onderzoek waarin het effect van een vertraagd in slaap vallen werd vergeleken met tijdelijke deprivatie van slaap op HGH-afscheiding.

  • Resultaten:

    Pieken in HGH-afscheiding vielen samen met de aanvang van slow-wave-slaap wanneer personen normaal om 2300 in slaap mochten vallen. Wanneer het begin van slaap was vertraagd tot 0200, waren de HGH-pieken ook aanzienlijk vertraagd. Deze pieken vielen weer samen met de aanvankelijke periodes van slow-wave-slaap. HGH-pieken waren niet aanzienlijk veranderd in nachten waarin slow-wave-slaap was ontnomen tussen 2300 en 0200, maar kwamen vooral voor na het begin van de slaap in plaats van tijdens de belangrijkste periode van slow-wave-slaap na 0200.

     

  • Conclusie:

    De timing van nachtelijke HGH-afscheiding is meer afhankelijk van het begin van de slaap dan van de slow-wave-slaap.

  • Born, J., Muth, S., Fehm, HL.: “The significance of sleep onset and slow wave sleep for nocturnal release of growth hormone (GH) and cortisol.” Psychoneuroendocrinology. 1988;13(3):233-43.  PMID: 3406323

Herdefinieer uw limieten met NiacinMax.

Bestel NiacinMax nu